PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_70.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family CO-like
Protein Properties Length: 381aa    MW: 41474 Da    PI: 5.7192
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_70.6genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.11.3e-062464438
                    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                                r+C+++ +   + +C+ ++ +lC++C    H        H+
  evm.model.supercontig_70.6 24 RMCDTCRSAACTVYCRADSAYLCANCDARVHAAnrvasrHE 64
                                68******99*****************99995555666676 PP

2zf-B_box30.57.7e-1066111342
                    zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                  ++C+ +e+ ++ + C+ +   lC++C   +H+       H++vp+
  evm.model.supercontig_70.6  66 VWVCESCERAPAAFLCKADAASLCASCDADIHSAnplarrHQRVPI 111
                                 689*****************************66899999**9997 PP

3CCT70.34.7e-24309352144
                         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                 Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  evm.model.supercontig_70.6 309 REARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 352
                                 9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.6652168IPR000315B-box-type zinc finger
SMARTSM003364.3E-102168IPR000315B-box-type zinc finger
CDDcd000218.54E-92468No hitNo description
PROSITE profilePS5011911.47664111IPR000315B-box-type zinc finger
PfamPF006439.8E-865111IPR000315B-box-type zinc finger
CDDcd000216.37E-967111No hitNo description
SMARTSM003362.0E-1169111IPR000315B-box-type zinc finger
PROSITE profilePS5101716.648309351IPR010402CCT domain
PfamPF062037.4E-18309351IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MLKEEISDGG SGGRGGGGEN NWARMCDTCR SAACTVYCRA DSAYLCANCD ARVHAANRVA  60
SRHERVWVCE SCERAPAAFL CKADAASLCA SCDADIHSAN PLARRHQRVP ILPISGCLYG  120
GPASEPGDEM GTTDDGFVTE EGIGEEEEEE AASWLLLNPG KNSNNNQSNG LLFGGDQVDE  180
YLDLVEYNCG GDQNQFHPQQ QFGVAVMEKS SSYGGDSVVP VQCAEGHHQF HHHNFQLGLD  240
YEPSKAHYTY SGSINHSVSM SSMEVGVVPE SGISEISVSH TRPPKGTIDL FCGNPNQIPV  300
ATQLSPLDRE ARVLRYREKK KTRKFEKTIR YASRKAYAET RPRIKGRFAK RTDHVDLEVD  360
QIFSTPLTAA DTGYGIVPSF *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11117GGRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4159223e-34DQ415922.1 Cleome spinosa clone BAC Cs1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436773.11e-175PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965021e-139COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A0D3R2G60.0A0A0D3R2G6_G
STRINGPOPTR_0017s14410.11e-173(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.18e-90CONSTANS-like 2